TMEM75 antibody (C-Term)
-
- Target See all TMEM75 products
- TMEM75 (Transmembrane Protein 75 (TMEM75))
- Binding Specificity
- C-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM75 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM75 antibody was raised against the C terminal of TMEM75
- Purification
- Affinity purified
- Immunogen
- TMEM75 antibody was raised using the C terminal of TMEM75 corresponding to a region with amino acids VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM75 Blocking Peptide, catalog no. 33R-9846, is also available for use as a blocking control in assays to test for specificity of this TMEM75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM75 (Transmembrane Protein 75 (TMEM75))
- Alternative Name
- TMEM75 (TMEM75 Products)
- Background
- The function of TMEM75 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 15 kDa (MW of target protein)
-