SLC37A3 antibody
-
- Target See all SLC37A3 products
- SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC37A3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- SLC37 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC37A3 Blocking Peptide, catalog no. 33R-2888, is also available for use as a blocking control in assays to test for specificity of this SLC37A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))
- Alternative Name
- SLC37A3 (SLC37A3 Products)
- Synonyms
- 2610507O21Rik antibody, AU044904 antibody, solute carrier family 37 member 3 antibody, solute carrier family 37 (glycerol-3-phosphate transporter), member 3 antibody, solute carrier family 37, member 3 antibody, SLC37A3 antibody, Slc37a3 antibody
- Background
- SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.
- Molecular Weight
- 54 kDa (MW of target protein)
-