SLC37A3 antibody

Catalog No. ABIN635164

Product Details anti-SLC37A3 Antibody

Target: SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC37A3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: SLC37 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC37A3 Blocking Peptide, catalog no. 33R-2888, is also available for use as a blocking control in assays to test for specificity of this SLC37A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC37A3

Target: SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))

Alternative Name: SLC37A3 (SLC37A3 Products)

Synonyms: 2610507O21Rik antibody, AU044904 antibody, solute carrier family 37 member 3 antibody, solute carrier family 37 (glycerol-3-phosphate transporter), member 3 antibody, solute carrier family 37, member 3 antibody, SLC37A3 antibody, Slc37a3 antibody

Background: SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.

Molecular Weight: 54 kDa (MW of target protein)