PORCN antibody

Catalog No. ABIN635157

Product Details anti-PORCN Antibody

Target: PORCN (Porcupine Homolog (PORCN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PORCN antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PORCN antibody was raised using a synthetic peptide corresponding to a region with amino acids ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PORCN Blocking Peptide, catalog no. 33R-1079, is also available for use as a blocking control in assays to test for specificity of this PORCN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PORCN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PORCN

Target: PORCN (Porcupine Homolog (PORCN))

Alternative Name: PORCN (PORCN Products)

Synonyms: 15175 antibody, CG6205 antibody, Dmel\\CG6205 antibody, Porc antibody, dmPorc antibody, l(1)17Ac antibody, poc antibody, porc antibody, DHOF antibody, FODH antibody, MG61 antibody, PORC antibody, PPN antibody, porcupine antibody, 2410004O13Rik antibody, AW045557 antibody, DXHXS7465e antibody, Mporc antibody, Mporc-a antibody, Mporc-b antibody, Mporc-c antibody, Mporc-d antibody, Ppn antibody, mMg61 antibody, RGD1564947 antibody, porcupine antibody, porcupine O-acyltransferase antibody, porcupine homolog (Drosophila) antibody, por antibody, PORCN antibody, Porcn antibody

Background: PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Molecular Weight: 51 kDa (MW of target protein)