PANX1 antibody (Middle Region)
-
- Target See all PANX1 Antibodies
- PANX1 (Pannexin 1 (PANX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mammalian
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PANX1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Pannexin 1 antibody was raised against the middle region of PANX1
- Cross-Reactivity
- Human
- Purification
- Affinity purified
- Immunogen
- Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN
- Top Product
- Discover our top product PANX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Pannexin 1 Blocking Peptide, catalog no. 33R-5005, is also available for use as a blocking control in assays to test for specificity of this Pannexin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PANX1 (Pannexin 1 (PANX1))
- Alternative Name
- Pannexin 1 (PANX1 Products)
- Background
- PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.
- Molecular Weight
- 47 kDa (MW of target protein)
-