PANX1 antibody (Middle Region)

Catalog No. ABIN635152

Product Details anti-PANX1 Antibody

Target: PANX1 (Pannexin 1 (PANX1))

Binding Specificity: Middle Region

Reactivity: Mammalian

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PANX1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Pannexin 1 antibody was raised against the middle region of PANX1

Cross-Reactivity: Human

Purification: Affinity purified

Immunogen: Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Pannexin 1 Blocking Peptide, catalog no. 33R-5005, is also available for use as a blocking control in assays to test for specificity of this Pannexin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PANX1

Target: PANX1 (Pannexin 1 (PANX1))

Alternative Name: Pannexin 1 (PANX1 Products)

Synonyms: panx1 antibody, zgc:55631 antibody, PANX1 antibody, px1 antibody, mrs1 antibody, pannexin1 antibody, Pannexin-1 antibody, MRS1 antibody, PX1 antibody, UNQ2529 antibody, AI847747 antibody, pannexin 1a antibody, pannexin 1 antibody, Pannexin 1 antibody, panx1a antibody, PANX1 antibody, panx1 antibody, Panx1 antibody

Background: PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Molecular Weight: 47 kDa (MW of target protein)