LRRC4C antibody (N-Term)
-
- Target See all LRRC4C Antibodies
- LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC4C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC4 C antibody was raised against the N terminal of LRRC4
- Purification
- Affinity purified
- Immunogen
- LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
- Top Product
- Discover our top product LRRC4C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC4C Blocking Peptide, catalog no. 33R-5546, is also available for use as a blocking control in assays to test for specificity of this LRRC4C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))
- Alternative Name
- LRRC4C (LRRC4C Products)
- Background
- NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-