Anoctamin 10 antibody (C-Term)

Catalog No. ABIN635146

Product Details anti-Anoctamin 10 Antibody

Target: Anoctamin 10 (ANO10)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Anoctamin 10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM16 K antibody was raised against the C terminal of TMEM16

Purification: Affinity purified

Immunogen: TMEM16 K antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM16K Blocking Peptide, catalog no. 33R-5070, is also available for use as a blocking control in assays to test for specificity of this TMEM16K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Anoctamin 10

Target: Anoctamin 10 (ANO10)

Alternative Name: TMEM16K (ANO10 Products)

Synonyms: TMEM16K antibody, ano10 antibody, zgc:114140 antibody, tmem16k antibody, SCAR10 antibody, AI604832 antibody, Tmem16k antibody, RGD1308260 antibody, anoctamin 10 antibody, anoctamin 10a antibody, transmembrane protein 16K antibody, anoctamin 10 L homeolog antibody, ANO10 antibody, ano10 antibody, ano10a antibody, MCYG_02694 antibody, MGYG_08424 antibody, ano10.L antibody, Ano10 antibody

Background: TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.

Molecular Weight: 76 kDa (MW of target protein)