UNC50 antibody
-
- Target See all UNC50 products
- UNC50 (Unc-50 Homolog (UNC50))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UNC50 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UNC50 Blocking Peptide, catalog no. 33R-5291, is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UNC50 (Unc-50 Homolog (UNC50))
- Alternative Name
- UNC50 (UNC50 Products)
- Background
- UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.
- Molecular Weight
- 30 kDa (MW of target protein)
-