Acsl3 antibody (N-Term)

Catalog No. ABIN635143

Product Details anti-Acsl3 Antibody

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Acsl3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACSL3 antibody was raised against the N terminal of ACSL3

Purification: Affinity purified

Immunogen: ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSL3 Blocking Peptide, catalog no. 33R-4845, is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Acsl3

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Alternative Name: ACSL3 (Acsl3 Products)

Synonyms: ACSL3 antibody, acsl3 antibody, fa07a08 antibody, im:7155129 antibody, si:dkey-20f20.5 antibody, wu:fa07a08 antibody, wu:fb34c03 antibody, si:dkeyp-109h9.2 antibody, ACS3 antibody, FACL3 antibody, PRO2194 antibody, 2610510B12Rik antibody, Acs3 antibody, C85929 antibody, Facl3 antibody, Pro2194 antibody, F15H21.7 antibody, F15H21_7 antibody, long-chain acyl-CoA synthetase 3 antibody, acyl-CoA synthetase long-chain family member 3 antibody, acyl-CoA synthetase long chain family member 3 antibody, acyl-CoA synthetase long chain family member 3b antibody, acyl-CoA synthetase long chain family member 3a antibody, AcsL3 antibody, AMP-dependent synthetase and ligase family protein antibody, ACSL3 antibody, acsl3b antibody, acsl3a antibody, acsL3 antibody, acsl3 antibody, Acsl3 antibody, LACS3 antibody

Background: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome