Synaptophysin antibody (N-Term)
-
- Target See all Synaptophysin (SYP) Antibodies
- Synaptophysin (SYP)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Synaptophysin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Synaptophysin antibody was raised against the N terminal of SYP
- Purification
- Affinity purified
- Immunogen
- Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
- Top Product
- Discover our top product SYP Primary Antibody
-
anti-Synaptophysin (SYP) (AA 225-253), (C-Term) antibody
SYP Reactivity: Human, Mouse WB, IF, IHC (p), FACS Host: Rabbit Polyclonal RB32966 unconjugated
anti-Synaptophysin (SYP) (C-Term) antibodySYP Reactivity: Human WB, IF, IHC (p), ICC, IHC (fro), IHC (wm) Host: Rabbit Polyclonal unconjugated
anti-Synaptophysin (SYP) (AA 150-250) antibodySYP Reactivity: Human WB, IHC, IF, IP Host: Rabbit Polyclonal unconjugated
anti-Synaptophysin (SYP) (AA 225-253), (C-Term) antibodySYP Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB32966 unconjugated
anti-Synaptophysin (SYP) (Internal Region) antibodySYP Reactivity: Human, Mouse, Rat WB, IHC, IF, ELISA, ICC Host: Rabbit Polyclonal unconjugated
anti-Synaptophysin (SYP) antibodySYP Reactivity: Human, Dog WB, IF Host: Mouse Monoclonal 5H2 unconjugated
anti-Synaptophysin (SYP) (N-Term) antibodySYP Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish (Danio rerio), Goat WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Synaptophysin (SYP) antibodySYP Reactivity: Human, Rat WB, IHC, ELISA Host: Mouse Monoclonal 7H12 unconjugated
anti-Synaptophysin (SYP) antibodyMicroarray verified SYP Reactivity: Human, Mouse IHC Host: Mouse Monoclonal MAB551901 unconjugated
anti-Synaptophysin (SYP) (AA 1-313) antibodySYP Reactivity: Human WB, ELISA Host: Mouse Monoclonal 3B3 unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Synaptophysin (SYP)
- Alternative Name
- Synaptophysin (SYP Products)
- Synonyms
- syp-B antibody, xsypii antibody, MGC86267 antibody, MRXSYP antibody, A230093K24Rik antibody, AI848995 antibody, Syn antibody, p38 antibody, Syp1 antibody, mrxsyp antibody, syp antibody, xsypi antibody, synaptophysin S homeolog antibody, synaptophysin antibody, synaptophysin L homeolog antibody, synaptophysin a antibody, syp.S antibody, SYP antibody, syp antibody, Syp antibody, syp.L antibody, sypa antibody
- Background
- Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity
-
