Anoctamin 6 antibody (Middle Region)
-
- Target See all Anoctamin 6 (ANO6) Antibodies
- Anoctamin 6 (ANO6)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Anoctamin 6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Anoctamin 6 antibody was raised against the middle region of ANO6
- Purification
- Affinity purified
- Immunogen
- Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
- Top Product
- Discover our top product ANO6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Anoctamin 6 Blocking Peptide, catalog no. 33R-4651, is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Anoctamin 6 (ANO6)
- Alternative Name
- Anoctamin 6 (ANO6 Products)
- Synonyms
- TMEM16F antibody, 2900059G15Rik antibody, AA407480 antibody, AW554778 antibody, F730003B03Rik antibody, Tmem16f antibody, BDPLT7 antibody, SCTS antibody, anoctamin 6 antibody, ANO6 antibody, ano6 antibody, Ano6 antibody
- Background
- TMEM16F may act as a calcium-activated chloride channel.
- Molecular Weight
- 106 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-