GPR177/WLS antibody (N-Term)

Catalog No. ABIN635133

Product Details anti-GPR177/WLS Antibody

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR177/WLS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GPR177 antibody was raised against the N terminal of GPR177

Purification: Affinity purified

Immunogen: GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR177 Blocking Peptide, catalog no. 33R-1477, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR177/WLS

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Alternative Name: GPR177 (WLS Products)

Synonyms: C1orf139 antibody, EVI antibody, GPR177 antibody, MRP antibody, mig-14 antibody, 5031439A09Rik antibody, AI173978 antibody, AI987742 antibody, Gpr177 antibody, gpr117 antibody, gpr177 antibody, sb:cb610 antibody, wu:fb36d04 antibody, wu:fb44d10 antibody, wu:fb50c06 antibody, zgc:64091 antibody, CG6210 antibody, Dmel\\CG6210 antibody, Evi antibody, Evi/Wls antibody, Srt antibody, Wls antibody, Wls/Evi antibody, evi antibody, srt antibody, wls/evi antibody, wntless Wnt ligand secretion mediator antibody, wntless homolog (Drosophila) antibody, wntless antibody, WLS antibody, Wls antibody, wls antibody

Background: GPR177 is a receptor for Wnt proteins in Wnt-secreting cells.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: WNT Signaling