BACE2 antibody (Middle Region)

Catalog No. ABIN635132

Product Details anti-BACE2 Antibody

Target: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BACE2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BACE2 antibody was raised against the middle region of BACE2

Purification: Affinity purified

Immunogen: BACE2 antibody was raised using the middle region of BACE2 corresponding to a region with amino acids SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BACE2 Blocking Peptide, catalog no. 33R-8612, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BACE2

Target: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Alternative Name: BACE2 (BACE2 Products)

Synonyms: AEPLC antibody, ALP56 antibody, ASP1 antibody, ASP21 antibody, BAE2 antibody, CEAP1 antibody, DRAP antibody, 1110059C24Rik antibody, AI850424 antibody, ARP1 antibody, CDA13 antibody, beta-site APP-cleaving enzyme 2 antibody, BACE2 antibody, Bace2 antibody

Background: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Molecular Weight: 37 kDa (MW of target protein)