GDAP1L1 antibody (N-Term)
-
- Target See all GDAP1L1 Antibodies
- GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GDAP1L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GDAP1 L1 antibody was raised against the N terminal of GDAP1 1
- Purification
- Affinity purified
- Immunogen
- GDAP1 L1 antibody was raised using the N terminal of GDAP1 1 corresponding to a region with amino acids ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT
- Top Product
- Discover our top product GDAP1L1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GDAP1L1 Blocking Peptide, catalog no. 33R-2689, is also available for use as a blocking control in assays to test for specificity of this GDAP1L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))
- Alternative Name
- GDAP1L1 (GDAP1L1 Products)
- Background
- The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.
- Molecular Weight
- 42 kDa (MW of target protein)
-