ANO3 antibody (C-Term)

Catalog No. ABIN635122

Product Details anti-ANO3 Antibody

Target: ANO3 (Anoctamin 3 (ANO3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANO3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM16 C antibody was raised against the C terminal of TMEM16

Purification: Affinity purified

Immunogen: TMEM16 C antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM16C Blocking Peptide, catalog no. 33R-1181, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANO3

Target: ANO3 (Anoctamin 3 (ANO3))

Alternative Name: TMEM16C (ANO3 Products)

Synonyms: TMEM16C antibody, anoctamin-3 antibody, C11orf25 antibody, DYT23 antibody, DYT24 antibody, AI838058 antibody, B230324K02Rik antibody, Tmem16c antibody, anoctamin 3 antibody, anoctamin-3 antibody, ANO3 antibody, LOC100453980 antibody, ano3 antibody, Ano3 antibody

Background: TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.

Molecular Weight: 115 kDa (MW of target protein)