ANO3 antibody (C-Term)
-
- Target See all ANO3 Antibodies
- ANO3 (Anoctamin 3 (ANO3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANO3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM16 C antibody was raised against the C terminal of TMEM16
- Purification
- Affinity purified
- Immunogen
- TMEM16 C antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL
- Top Product
- Discover our top product ANO3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM16C Blocking Peptide, catalog no. 33R-1181, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANO3 (Anoctamin 3 (ANO3))
- Alternative Name
- TMEM16C (ANO3 Products)
- Background
- TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.
- Molecular Weight
- 115 kDa (MW of target protein)
-