SFXN1 antibody (N-Term)

Catalog No. ABIN635095

Product Details anti-SFXN1 Antibody

Target: SFXN1 (Sideroflexin 1 (SFXN1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFXN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Sideroflexin 1 antibody was raised against the N terminal of SFXN1

Purification: Affinity purified

Immunogen: Sideroflexin 1 antibody was raised using the N terminal of SFXN1 corresponding to a region with amino acids MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sideroflexin 1 Blocking Peptide, catalog no. 33R-6424, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFXN1

Target: SFXN1 (Sideroflexin 1 (SFXN1))

Alternative Name: Sideroflexin 1 (SFXN1 Products)

Synonyms: zgc:100851 antibody, 2810002O05Rik antibody, A930015P12Rik antibody, f antibody, Sideroflexin 1 antibody, sideroflexin 1 antibody, sideroflexin 1 L homeolog antibody, Bm1_35025 antibody, sfxn1 antibody, sfxn1.L antibody, SFXN1 antibody, Sfxn1 antibody

Background: SFXN1 might be involved in the transport of a component required for iron utilization into or out of the mitochondria.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis