MRS2 antibody (Middle Region)

Catalog No. ABIN635094

Product Details anti-MRS2 Antibody

Target: MRS2 (MRS2 Magnesium Homeostasis Factor Homolog (MRS2))

Binding Specificity: Middle Region

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRS2 L antibody was raised against the middle region of Mrs2

Purification: Affinity purified

Immunogen: MRS2 L antibody was raised using the middle region of Mrs2 corresponding to a region with amino acids LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRS2L Blocking Peptide, catalog no. 33R-4838, is also available for use as a blocking control in assays to test for specificity of this MRS2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRS2

Target: MRS2 (MRS2 Magnesium Homeostasis Factor Homolog (MRS2))

Alternative Name: MRS2L (MRS2 Products)

Synonyms: Gm902 antibody, HPT antibody, Mrs2l antibody, RPT antibody, Rpt antibody, MRS2L antibody, MRS2 magnesium transporter antibody, MRS2, magnesium transporter antibody, Mrs2 antibody, MRS2 antibody

Background: MRS2L is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.

Molecular Weight: 50 kDa (MW of target protein)