NNT antibody (N-Term)
-
- Target See all NNT Antibodies
- NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NNT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NNT antibody was raised against the N terminal of NNT
- Purification
- Affinity purified
- Immunogen
- NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
- Top Product
- Discover our top product NNT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NNT Blocking Peptide, catalog no. 33R-4206, is also available for use as a blocking control in assays to test for specificity of this NNT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))
- Alternative Name
- NNT (NNT Products)
- Background
- NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.
- Molecular Weight
- 114 kDa (MW of target protein)
- Pathways
- Proton Transport
-