RHOT1 antibody (N-Term)
-
- Target See all RHOT1 Antibodies
- RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHOT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHOT1 antibody was raised against the N terminal of RHOT1
- Purification
- Affinity purified
- Immunogen
- RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHOT1 Blocking Peptide, catalog no. 33R-2585, is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody
- Restrictions
- For Research Use only
-
- by
- Department of Biochemistry, University of Utah, Shaw lab
- No.
- #100007
- Date
- 09/12/2015
- Antigen
- Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term)
- Lot Number
- Method validated
- Western Blotting
- Positive Control
- 100ng Recombinant Miro1; 30ug Mitochondria isolated from Miro1 WT MEFs and Miro1 KO MEFs expressing Myc-Miro1; in house purification and isolation Isolated mitochondria from immortalized Miro1 WT MEFs rMiro1, mtMiro1 wt MEFs, mtMiro1 KO MEFs plus Venus-Miro1
- Negative Control
- 100ng Recombinant Miro2, 30ug Mitochondria isolated from Miro1 KO MEFs and Miro1 KO MEFs expressing Myc-Miro2; in house purification and isolation
- Notes
- ABIN635090 is specific for Miro1 without cross-reaction with Miro2.
- Primary Antibody
- ABIN635090
- Secondary Antibody
- Goat-anti-rabbit IgG HRP conjugated (Sigma A0545-1M2 - 057K4802) 1:2000 in TBS + 0.05% Tween-20 + 5% non-fat dry milk
- Full Protocol
- Transfection of immortalized Miro1-/- MEFs with Myc-Miro1-V1 or Myc-Miro2-V1 (Published in Nguyen et al., 2014 (PNAS, 10.1073/pnas.1402449111))
- Isolation of mitochondria from immortalized Miro1+/+, Miro1-/-, Miro1-/- + Myc-Miro1 and Miro1-/- + Myc-Miro2 MEFs
- Determine protein concentration and snap freeze mitochondria in liquid nitrogen
Day 1
- Thaw 30ug mitochondria per lane on ice
- Thaw 100ng recombinant Miro1 and Miro2 per lane on ice (in house purification)
- Add 2x Laemmli buffer + 2% BME to samples and denature for 5 min at 95C
- Load 30ug/lane mitochondria and 100ng/lane recombinant protein onto 12.5 % SDS-PAGE
- Fermentas PageRuler Plus Prestained (2ul) - Lane 7 / 14 / 21
- Recombinant Miro1- Lane 1 / 8 / 15
- Recombinant Miro2- Lane 2 / 9 / 16
- Miro1+/+ mitochondria- Lane 3 / 10 / 17
- Miro1-/- mitochondria- Lane 4 / 11 / 18 / 22
- Miro1-/- + Myc-Miro1-V1 mitochondria- Lane 5 / 12 / 19 / 23
- Miro1-/- + Myc-Miro2-V1 mitochondria- Lane 6 / 13 / 20 / 24
- Run gel 40mA 180V for 3h
- Semi-dry transfer to PVDF 250mA 15V for 2h
- Block with TBS + 3% BSA for 1h at RT
Lanes Antibody Host Dilution In 1-6 Anti-Miro1 Other company - - - 8-13 Anti-Miro1 ABIN634527v rabbit 1:1000 TBST + 3% BSA 15-20 Anti-Miro1 ABIN635090 rabbit 1:1000 TBST + 3% BSA 22-24 Anti-Myc - - - All lanes Anti-Cyt c - - - Anti-PRX3 - - - - Day 2
- 3x washing with TBS + 0.05% Tween-20 for 5'
- 2nd AB for 1h at RT
- Goat-anti-rabbit IgG HRP (Sigma A0545-1M2 - 057K4802)
- 1:2000 in TBS + 0.05% Tween-20 + 5% non-fat dry milk3x washing with TBS for 10'
- Detection with homemade ECL prepared according to Haan and Behrmann, 2007 (J Immunol Methods, 10.1016/j.jim.2006.07.027) on a Bio-Rad imaging system
- Experimental Notes
Validation #100007 (Western Blotting)Validation ImagesFull Methods -
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))
- Alternative Name
- RHOT1 (RHOT1 Products)
- Background
- RHOT1 is mitochondrial GTPase involved in mitochondrial trafficking. It is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
- Molecular Weight
- 75 kDa (MW of target protein)
-