SLC25A39 antibody (C-Term)
-
- Target See all SLC25A39 Antibodies
- SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Dog, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A39 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SLC25 A39 antibody was raised against the C terminal of SLC25 39
- Purification
- Affinity purified
- Immunogen
- SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
- Top Product
- Discover our top product SLC25A39 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A39 Blocking Peptide, catalog no. 33R-8252, is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))
- Alternative Name
- SLC25A39 (SLC25A39 Products)
- Background
- SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.
- Molecular Weight
- 39 kDa (MW of target protein)
-