SLC25A32 antibody (N-Term)
-
- Target See all SLC25A32 Antibodies
- SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A32 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC25 A32 antibody was raised against the N terminal of SLC25 32
- Purification
- Affinity purified
- Immunogen
- SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT
- Top Product
- Discover our top product SLC25A32 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A32 Blocking Peptide, catalog no. 33R-9795, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))
- Alternative Name
- SLC25A32 (SLC25A32 Products)
- Background
- SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-