SLC25A32 antibody (N-Term)

Catalog No. ABIN635067

Product Details anti-SLC25A32 Antibody

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A32 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC25 A32 antibody was raised against the N terminal of SLC25 32

Purification: Affinity purified

Immunogen: SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A32 Blocking Peptide, catalog no. 33R-9795, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A32

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Alternative Name: SLC25A32 (SLC25A32 Products)

Synonyms: fi40c12 antibody, mftc antibody, wu:fi40c12 antibody, zgc:55610 antibody, zgc:110786 antibody, RGD1565789 antibody, MFT antibody, MFTC antibody, 2610043O12Rik antibody, Mftc antibody, solute carrier family 25 (mitochondrial folate carrier), member 32a antibody, solute carrier family 25 (mitochondrial folate carrier), member 32b antibody, NAD transporter antibody, mitochondrial folate transporter/carrier antibody, solute carrier family 25 member 32 antibody, solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog antibody, solute carrier family 25, member 32 antibody, slc25a32a antibody, slc25a32b antibody, SJAG_04328 antibody, PAAG_07673 antibody, PAAG_03661 antibody, MCYG_01228 antibody, MGYG_01778 antibody, SLC25A32 antibody, Slc25a32 antibody, slc25a32.L antibody

Background: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport