SLC25A21 antibody

Catalog No. ABIN635065

Product Details anti-SLC25A21 Antibody

Target: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A21 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A21 Blocking Peptide, catalog no. 33R-3137, is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A21

Target: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Alternative Name: SLC25A21 (Slc25a21 Products)

Synonyms: zgc:153387 antibody, ODC antibody, ODC1 antibody, Odc1 antibody, 9930033G19Rik antibody, A630030I10 antibody, BB158148 antibody, solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 antibody, solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 L homeolog antibody, solute carrier family 25 member 21 antibody, solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 antibody, slc25a21 antibody, slc25a21.L antibody, SLC25A21 antibody, Slc25a21 antibody

Background: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome