SLC25A21 antibody
-
- Target See all SLC25A21 (Slc25a21) Antibodies
- SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A21 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL
- Top Product
- Discover our top product Slc25a21 Primary Antibody
-
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (Internal Region) antibody
Slc25a21 Reactivity: Human, Rat, Mouse WB, ELISA, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (Internal Region) antibodySlc25a21 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (AA 215-264) antibodySlc25a21 Reactivity: Human, Rat, Mouse, Rabbit, Cow, Zebrafish (Danio rerio), Guinea Pig, Horse, Pig, Bat, Chicken, Monkey, Drosophila melanogaster WB Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (AA 72-121) antibodySlc25a21 Reactivity: Human, Rat, Mouse, Rabbit, Cow, Zebrafish (Danio rerio), Guinea Pig, Horse, Dog, Pig, Bat, Chicken, Monkey, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (AA 36-99) antibodySlc25a21 Reactivity: Human ELISA Host: Mouse Monoclonal 2C9 unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (AA 134-183) antibodySlc25a21 Reactivity: Human, Rat, Mouse WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (Internal Region) antibodySlc25a21 Reactivity: Human, Rat, Mouse WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
anti-Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (N-Term) antibodySlc25a21 Reactivity: Human, Rat, Mouse, Rabbit, Cow, Zebrafish (Danio rerio), Guinea Pig, Horse, Dog, Saccharomyces cerevisiae WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A21 Blocking Peptide, catalog no. 33R-3137, is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))
- Alternative Name
- SLC25A21 (Slc25a21 Products)
- Background
- SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-
