CXorf66 antibody (Middle Region)

Catalog No. ABIN635057

Product Details anti-CXorf66 Antibody

Target: CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXorf66 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CXorf66 antibody was raised against the middle region of CXorf66

Purification: Affinity purified

Immunogen: CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXorf66 Blocking Peptide, catalog no. 33R-7216, is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXorf66 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CXorf66

Target: CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))

Alternative Name: CXorf66 (CXorf66 Products)

Synonyms: chromosome X open reading frame 66 antibody, CXorf66 antibody

Background: The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.

Molecular Weight: 40 kDa (MW of target protein)