CEND1 antibody (N-Term)

Catalog No. ABIN635055

Product Details anti-CEND1 Antibody

Target: CEND1 (Cell Cycle Exit and Neuronal Differentiation 1 (CEND1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEND1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CEND1 antibody was raised against the N terminal of CEND1

Purification: Affinity purified

Immunogen: CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CEND1 Blocking Peptide, catalog no. 33R-5964, is also available for use as a blocking control in assays to test for specificity of this CEND1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CEND1

Target: CEND1 (Cell Cycle Exit and Neuronal Differentiation 1 (CEND1))

Alternative Name: CEND1 (CEND1 Products)

Synonyms: BM88 antibody, 1500001H12Rik antibody, AI415214 antibody, C38 antibody, RGD1309401 antibody, cell cycle exit and neuronal differentiation 1 antibody, CEND1 antibody, Cend1 antibody

Background: CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.

Molecular Weight: 15 kDa (MW of target protein)