AFG3L2 antibody
-
- Target See all AFG3L2 Antibodies
- AFG3L2 (AFG3-Like Protein 2 (AFG3L2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AFG3L2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AFG3 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS
- Top Product
- Discover our top product AFG3L2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AFG3L2 Blocking Peptide, catalog no. 33R-9704, is also available for use as a blocking control in assays to test for specificity of this AFG3L2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFG0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AFG3L2 (AFG3-Like Protein 2 (AFG3L2))
- Alternative Name
- AFG3L2 (AFG3L2 Products)
- Synonyms
- MGC147390 antibody, si:ch211-12e1.4 antibody, SCA28 antibody, SPAX5 antibody, 2310036I02Rik antibody, AW260507 antibody, Emv66 antibody, par antibody, AFG3 like matrix AAA peptidase subunit 2 antibody, AFG3-like protein 2 antibody, AFG3 ATPase family gene 3-like 2 (S. cerevisiae) antibody, AFG3-like AAA ATPase 2 antibody, AFG3-like AAA ATPase 2 L homeolog antibody, AFG3L2 antibody, LOC578526 antibody, afg3l2 antibody, afg3l2.L antibody, Afg3l2 antibody
- Background
- AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
- Molecular Weight
- 88 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-