COX10 antibody (Middle Region)
-
- Target See all COX10 Antibodies
- COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COX10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- COX10 antibody was raised against the middle region of COX10
- Purification
- Affinity purified
- Immunogen
- COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL
- Top Product
- Discover our top product COX10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
COX10 Blocking Peptide, catalog no. 33R-2170, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))
- Alternative Name
- COX10 (COX10 Products)
- Synonyms
- 2410004F01Rik antibody, AU042636 antibody, im:7145568 antibody, im:7157205 antibody, wu:fb18a03 antibody, F4I1.50 antibody, F4I1_50 antibody, cytochrome c oxidase 10 antibody, Cox10 antibody, cytochrome c oxidase assembly protein 10 antibody, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor antibody, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor L homeolog antibody, COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor antibody, cytochrome c oxidase 10 antibody, protoheme IX farnesyltransferase, mitochondrial antibody, Cox10 antibody, cox10 antibody, cox10.L antibody, COX10 antibody, LOC100732273 antibody
- Background
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase.
- Molecular Weight
- 49 kDa (MW of target protein)
-