SLC25A32 antibody (Middle Region)
-
- Target See all SLC25A32 Antibodies
- SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A32 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC25 A32 antibody was raised against the middle region of SLC25 32
- Purification
- Affinity purified
- Immunogen
- SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID
- Top Product
- Discover our top product SLC25A32 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A32 Blocking Peptide, catalog no. 33R-6857, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))
- Alternative Name
- SLC25A32 (SLC25A32 Products)
- Background
- SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-