SLC25A28 antibody (C-Term)

Catalog No. ABIN635044

Product Details anti-SLC25A28 Antibody

Target: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A28 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC25 A28 antibody was raised against the C terminal of SLC25 28

Purification: Affinity purified

Immunogen: SLC25 A28 antibody was raised using the C terminal of SLC25 28 corresponding to a region with amino acids NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A28 Blocking Peptide, catalog no. 33R-6904, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A28

Target: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Alternative Name: SLC25A28 (SLC25A28 Products)

Synonyms: MFRN2 antibody, MRS3/4 antibody, MRS4L antibody, 2210403D18Rik antibody, Mfrn2 antibody, Mrs3/4 antibody, mfrn2 antibody, wu:fc48b02 antibody, wu:fc66h02 antibody, zgc:64212 antibody, mrs3/4 antibody, mrs4l antibody, npd016 antibody, slc25a28-a antibody, slc25a28-b antibody, slc25a28 antibody, solute carrier family 25 member 28 antibody, mitoferrin-2-like antibody, solute carrier family 25, member 28 antibody, solute carrier family 25 (mitochondrial iron transporter), member 28 antibody, solute carrier family 25 member 28 L homeolog antibody, solute carrier family 25 member 28 S homeolog antibody, SLC25A28 antibody, LOC100226611 antibody, Slc25a28 antibody, slc25a28 antibody, slc25a28.L antibody, slc25a28.S antibody

Background: SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis