MAVS antibody (C-Term)
-
- Target See all MAVS Antibodies
- MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAVS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VISA antibody was raised against the C terminal of VISA
- Purification
- Affinity purified
- Immunogen
- VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ
- Top Product
- Discover our top product MAVS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VISA Blocking Peptide, catalog no. 33R-9412, is also available for use as a blocking control in assays to test for specificity of this VISA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VISA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))
- Alternative Name
- VISA (MAVS Products)
- Synonyms
- CARDIF antibody, IPS-1 antibody, IPS1 antibody, VISA antibody, D430028G21Rik antibody, Visa antibody, cardif antibody, wu:fj20d04 antibody, zgc:158392 antibody, mitochondrial antiviral signaling protein antibody, MAVS antibody, Mavs antibody, mavs antibody
- Background
- Double-stranded RNA viruses are recognised in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic RNA helicases MDA5 and RIGI (ROBO3). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Inositol Metabolic Process, Hepatitis C
-