OLFML2B antibody (N-Term)

Catalog No. ABIN635031

Product Details anti-OLFML2B Antibody

Target: OLFML2B (Olfactomedin-Like 2B (OLFML2B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLFML2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OLFML2 B antibody was raised against the N terminal of OLFML2

Purification: Affinity purified

Immunogen: OLFML2 B antibody was raised using the N terminal of OLFML2 corresponding to a region with amino acids EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLFML2B Blocking Peptide, catalog no. 33R-2397, is also available for use as a blocking control in assays to test for specificity of this OLFML2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLFML2B

Target: OLFML2B (Olfactomedin-Like 2B (OLFML2B))

Alternative Name: OLFML2B (OLFML2B Products)

Synonyms: RP11-227F8.1 antibody, 1110018N05Rik antibody, 4832415H08Rik antibody, AI467542 antibody, olfactomedin like 2B antibody, olfactomedin-like 2B antibody, olfactomedin-like 2Bb antibody, OLFML2B antibody, Olfml2b antibody, olfml2bb antibody

Background: The function of OLFML2B protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 84 kDa (MW of target protein)