ACSL1 antibody (N-Term)

Catalog No. ABIN635029

Product Details anti-ACSL1 Antibody

Target: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACSL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACSL1 antibody was raised against the N terminal of ACSL1

Purification: Affinity purified

Immunogen: ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSL1 Blocking Peptide, catalog no. 33R-1349, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACSL1

Target: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Alternative Name: ACSL1 (Acsl1 Products)

Synonyms: ACS1 antibody, FACL1 antibody, FACL2 antibody, LACS antibody, LACS1 antibody, LACS2 antibody, Acas antibody, Acas1 antibody, Acs antibody, FACS antibody, Facl2 antibody, ACS antibody, COAA antibody, zgc:110081 antibody, CER8 antibody, ECERIFERUM 8 antibody, LONG-CHAIN ACYL-COA SYNTHASE 1 antibody, T8I13.8 antibody, F13F21.14 antibody, F13F21_14 antibody, LATERAL ROOT DEVELOPMENT 2 antibody, LRD2 antibody, long-chain acyl-CoA synthetase 2 antibody, acyl-CoA synthetase long chain family member 1 antibody, acyl-CoA synthetase long-chain family member 1 antibody, acyl-CoA synthetase long chain family member 1a antibody, AMP-dependent synthetase and ligase family protein antibody, long-chain acyl-CoA synthetase 2 antibody, ACSL1 antibody, Acsl1 antibody, acsl1a antibody, LACS1 antibody, LACS2 antibody

Background: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Molecular Weight: 78 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha