MARCO antibody (N-Term)

Catalog No. ABIN635028

Product Details anti-MARCO Antibody

Target: MARCO (Macrophage Receptor with Collagenous Structure (MARCO))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MARCO antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MARCO antibody was raised against the N terminal of MARCO

Purification: Affinity purified

Immunogen: MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MARCO Blocking Peptide, catalog no. 33R-7477, is also available for use as a blocking control in assays to test for specificity of this MARCO antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARCO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MARCO

Target: MARCO (Macrophage Receptor with Collagenous Structure (MARCO))

Alternative Name: MARCO (MARCO Products)

Synonyms: AI323439 antibody, Ly112 antibody, Scara2 antibody, SCARA2 antibody, macrophage receptor with collagenous structure antibody, MARCO antibody, Marco antibody

Background: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Activation of Innate immune Response