C16orf58 antibody (N-Term)

Catalog No. ABIN635025

Product Details anti-C16orf58 Antibody

Target: C16orf58 (Chromosome 16 Open Reading Frame 58 (C16orf58))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C16orf58 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C16 ORF58 antibody was raised against the N terminal Of C16 rf58

Purification: Affinity purified

Immunogen: C16 ORF58 antibody was raised using the N terminal Of C16 rf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C16ORF58 Blocking Peptide, catalog no. 33R-7482, is also available for use as a blocking control in assays to test for specificity of this C16ORF58 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C16orf58

Target: C16orf58 (Chromosome 16 Open Reading Frame 58 (C16orf58))

Alternative Name: C16ORF58 (C16orf58 Products)

Synonyms: RUS antibody, chromosome 16 open reading frame 58 antibody, chromosome 20 open reading frame, human C16orf58 antibody, C16orf58 antibody, C20H16orf58 antibody, c16orf58 antibody

Background: The function of C16orf58 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 51 kDa (MW of target protein)