NCAM2 antibody (Middle Region)
-
- Target See all NCAM2 Antibodies
- NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NCAM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NCAM2 antibody was raised against the middle region of NCAM2
- Purification
- Affinity purified
- Immunogen
- NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
- Top Product
- Discover our top product NCAM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))
- Alternative Name
- NCAM2 (NCAM2 Products)
- Synonyms
- NCAM21 antibody, Ncam-2 antibody, Ocam antibody, RNCAM antibody, zOCAM antibody, OCAM-GPI antibody, NCAM2 antibody, ncam21 antibody, neural cell adhesion molecule 2 antibody, zgc:152904 antibody, NCAM2 antibody, Ncam2 antibody, ncam2 antibody, LOC100471034 antibody, zgc:152904 antibody
- Background
- The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
- Molecular Weight
- 91 kDa (MW of target protein)
-