C14orf180 antibody (N-Term)

Catalog No. ABIN635016

Product Details anti-C14orf180 Antibody

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C14orf180 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF180 antibody was raised against the N terminal Of C14 rf180

Purification: Affinity purified

Immunogen: C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF180 Blocking Peptide, catalog no. 33R-2321, is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C14orf180

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Alternative Name: C14ORF180 (C14orf180 Products)

Synonyms: C14orf77 antibody, NRAC antibody, Nrac antibody, C21H14orf180 antibody, chromosome 14 open reading frame 180 antibody, RIKEN cDNA A530016L24 gene antibody, chromosome 21 open reading frame, human C14orf180 antibody, C14orf180 antibody, A530016L24Rik antibody, C21H14orf180 antibody

Background: C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.

Molecular Weight: 18 kDa (MW of target protein)