HSD3B2 antibody (N-Term)
-
- Target See all HSD3B2 Antibodies
- HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSD3B2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HSD3 B2 antibody was raised against the N terminal of HSD3 2
- Purification
- Affinity purified
- Immunogen
- HSD3 B2 antibody was raised using the N terminal of HSD3 2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
- Top Product
- Discover our top product HSD3B2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSD3B2 Blocking Peptide, catalog no. 33R-3671, is also available for use as a blocking control in assays to test for specificity of this HSD3B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))
- Alternative Name
- HSD3B2 (HSD3B2 Products)
- Background
- 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis
-