HSD3B2 antibody (N-Term)

Catalog No. ABIN635014

Product Details anti-HSD3B2 Antibody

Target: HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD3B2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSD3 B2 antibody was raised against the N terminal of HSD3 2

Purification: Affinity purified

Immunogen: HSD3 B2 antibody was raised using the N terminal of HSD3 2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD3B2 Blocking Peptide, catalog no. 33R-3671, is also available for use as a blocking control in assays to test for specificity of this HSD3B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD3B2

Target: HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))

Alternative Name: HSD3B2 (HSD3B2 Products)

Synonyms: HSD3B antibody, HSDB antibody, SDR11E2 antibody, Hsd3b1 antibody, 3b-HSD antibody, HSD3B1 antibody, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 antibody, HSD3B2 antibody, Hsd3b2 antibody

Background: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis