NBC4 antibody (Middle Region)
-
- Target See all NBC4 Antibodies
- NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NBC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC4 A5 antibody was raised against the middle region of SLC4 5
- Purification
- Affinity purified
- Immunogen
- SLC4 A5 antibody was raised using the middle region of SLC4 5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL
- Top Product
- Discover our top product NBC4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC4A5 Blocking Peptide, catalog no. 33R-8521, is also available for use as a blocking control in assays to test for specificity of this SLC4A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))
- Alternative Name
- SLC4A5 (NBC4 Products)
- Synonyms
- NBC4 antibody, solute carrier family 4 member 5 antibody, SLC4A5 antibody, Slc4a5 antibody
- Background
- This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation.
- Molecular Weight
- 126 kDa (MW of target protein)
-