TM7SF2 antibody (N-Term)

Catalog No. ABIN635009

Product Details anti-TM7SF2 Antibody

Target: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM7SF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TM7 SF2 antibody was raised against the N terminal of TM7 F2

Purification: Affinity purified

Immunogen: TM7 SF2 antibody was raised using the N terminal of TM7 F2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM7SF2 Blocking Peptide, catalog no. 33R-4757, is also available for use as a blocking control in assays to test for specificity of this TM7SF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM7SF2

Target: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Alternative Name: TM7SF2 (TM7SF2 Products)

Synonyms: 3110041O18Rik antibody, ANG1 antibody, C14SR antibody, Dhcr14 antibody, DHCR14A antibody, NET47 antibody, zgc:103611 antibody, tm7sf2 antibody, transmembrane 7 superfamily member 2 antibody, transmembrane 7 superfamily member 2 L homeolog antibody, TM7SF2 antibody, Tm7sf2 antibody, tm7sf2 antibody, tm7sf2.L antibody

Background: TM7SF2 is involved in the conversion of lanosterol to cholesterol.

Molecular Weight: 46 kDa (MW of target protein)