SRD5A2 antibody

Catalog No. ABIN635007

Product Details anti-SRD5A2 Antibody

Target: SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRD5A2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SRD5 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRD5A2 Blocking Peptide, catalog no. 33R-4423, is also available for use as a blocking control in assays to test for specificity of this SRD5A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRD5A2

Target: SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))

Alternative Name: SRD5A2 (SRD5A2 Products)

Synonyms: S5AR 2 antibody, 5ART2 antibody, SRD5alpha2 antibody, SRD5A2 antibody, Srd5a2 antibody, CH73-233A22.6 antibody, wu:fk70d02 antibody, zgc:109942 antibody, zgc:112208 antibody, zgc:112455 antibody, steroid 5 alpha-reductase 2 antibody, steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) antibody, 3-oxo-5-alpha-steroid 4-dehydrogenase 2 antibody, steroid-5-alpha-reductase, alpha polypeptide 2a antibody, steroid-5-alpha-reductase, alpha polypeptide 2b antibody, SRD5A2 antibody, Srd5a2 antibody, srd5a2 antibody, LOC100125532 antibody, srd5a2a antibody, srd5a2b antibody

Background: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis