TMEM138 antibody (N-Term)

Catalog No. ABIN635004

Product Details anti-TMEM138 Antibody

Target: TMEM138 (Transmembrane Protein 138 (TMEM138))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM138 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM138 antibody was raised against the N terminal of TMEM138

Purification: Affinity purified

Immunogen: TMEM138 antibody was raised using the N terminal of TMEM138 corresponding to a region with amino acids MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM138 Blocking Peptide, catalog no. 33R-6207, is also available for use as a blocking control in assays to test for specificity of this TMEM138 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM138 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM138

Target: TMEM138 (Transmembrane Protein 138 (TMEM138))

Alternative Name: TMEM138 (TMEM138 Products)

Synonyms: MGC79801 antibody, 1700113I01Rik antibody, 2900055D14Rik antibody, transmembrane protein 138 antibody, TMEM138 antibody, tmem138 antibody, Tsp_00664 antibody, Tmem138 antibody

Background: TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.

Molecular Weight: 19 kDa (MW of target protein)