CEACAM16 antibody (Middle Region)
-
- Target See all CEACAM16 Antibodies
- CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CEACAM16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CEACAM16 antibody was raised against the middle region of CEACAM16
- Purification
- Affinity purified
- Immunogen
- CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC
- Top Product
- Discover our top product CEACAM16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CEACAM16 Blocking Peptide, catalog no. 33R-9368, is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))
- Alternative Name
- CEACAM16 (CEACAM16 Products)
- Background
- CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-