ALG11 antibody (C-Term)

Catalog No. ABIN634990

Product Details anti-ALG11 Antibody

Target: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG11 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ALG11 antibody was raised against the C terminal of ALG11

Purification: Affinity purified

Immunogen: ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALG11 Blocking Peptide, catalog no. 33R-5030, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG11

Target: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Alternative Name: ALG11 (ALG11 Products)

Synonyms: UTP14C antibody, CDG1P antibody, GT8 antibody, RGD1564725 antibody, AI849156 antibody, AW492253 antibody, B230397C21 antibody, si:dkey-1h24.5 antibody, wu:fj04e04 antibody, asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase antibody, ALG11, alpha-1,2-mannosyltransferase antibody, ALG11, alpha-1,2-mannosyltransferase L homeolog antibody, asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase) antibody, alg11 antibody, ALG11 antibody, alg11.L antibody, Alg11 antibody

Background: ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).

Molecular Weight: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome