VSIG8 antibody (N-Term)

Catalog No. ABIN634989

Product Details anti-VSIG8 Antibody

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VSIG8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VSIG8 antibody was raised against the N terminal of VSIG8

Purification: Affinity purified

Immunogen: VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VSIG8 Blocking Peptide, catalog no. 33R-3838, is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VSIG8

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Alternative Name: VSIG8 (VSIG8 Products)

Synonyms: A030011M19 antibody, EG240916 antibody, RGD1562464 antibody, zgc:110326 antibody, V-set and immunoglobulin domain containing 8 antibody, V-set and immunoglobulin domain-containing protein 8 antibody, V-set and immunoglobulin domain containing 8a antibody, Vsig8 antibody, VSIG8 antibody, LOC100403027 antibody, vsig8a antibody

Background: VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.

Molecular Weight: 44 kDa (MW of target protein)