VSIG8 antibody (N-Term)
-
- Target See all VSIG8 Antibodies
- VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))
-
Binding Specificity
- N-Term
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VSIG8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VSIG8 antibody was raised against the N terminal of VSIG8
- Purification
- Affinity purified
- Immunogen
- VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
- Top Product
- Discover our top product VSIG8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VSIG8 Blocking Peptide, catalog no. 33R-3838, is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))
- Alternative Name
- VSIG8 (VSIG8 Products)
- Synonyms
- A030011M19 antibody, EG240916 antibody, RGD1562464 antibody, zgc:110326 antibody, V-set and immunoglobulin domain containing 8 antibody, V-set and immunoglobulin domain-containing protein 8 antibody, V-set and immunoglobulin domain containing 8a antibody, Vsig8 antibody, VSIG8 antibody, LOC100403027 antibody, vsig8a antibody
- Background
- VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.
- Molecular Weight
- 44 kDa (MW of target protein)
-