GGT7 antibody (C-Term)
-
- Target See all GGT7 Antibodies
- GGT7 (gamma-Glutamyltransferase 7 (GGT7))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GGT7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GGTL3 antibody was raised against the C terminal Of Ggtl3
- Purification
- Affinity purified
- Immunogen
- GGTL3 antibody was raised using the C terminal Of Ggtl3 corresponding to a region with amino acids ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC
- Top Product
- Discover our top product GGT7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GGTL3 Blocking Peptide, catalog no. 33R-4055, is also available for use as a blocking control in assays to test for specificity of this GGTL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGT7 (gamma-Glutamyltransferase 7 (GGT7))
- Alternative Name
- GGTL3 (GGT7 Products)
- Background
- GGTL3 is an enzyme involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.
- Molecular Weight
- 70 kDa (MW of target protein)
-