GGT7 antibody (C-Term)

Catalog No. ABIN634986

Product Details anti-GGT7 Antibody

Target: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GGT7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GGTL3 antibody was raised against the C terminal Of Ggtl3

Purification: Affinity purified

Immunogen: GGTL3 antibody was raised using the C terminal Of Ggtl3 corresponding to a region with amino acids ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GGTL3 Blocking Peptide, catalog no. 33R-4055, is also available for use as a blocking control in assays to test for specificity of this GGTL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GGT7

Target: GGT7 (gamma-Glutamyltransferase 7 (GGT7))

Alternative Name: GGTL3 (GGT7 Products)

Synonyms: D20S101 antibody, GGT4 antibody, GGTL3 antibody, GGTL5 antibody, dJ18C9.2 antibody, 1110017C11Rik antibody, 6330563L03Rik antibody, Ggtl3 antibody, gamma-glutamyltransferase 7 antibody, GGT7 antibody, Ggt7 antibody

Background: GGTL3 is an enzyme involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. GGTL3 consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis.

Molecular Weight: 70 kDa (MW of target protein)