CKLF antibody (N-Term)
-
- Target See all CKLF Antibodies
- CKLF (Chemokine-Like Factor (CKLF))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CKLF antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CKLF antibody was raised against the N terminal of CKLF
- Purification
- Affinity purified
- Immunogen
- CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG
- Top Product
- Discover our top product CKLF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CKLF Blocking Peptide, catalog no. 33R-5854, is also available for use as a blocking control in assays to test for specificity of this CKLF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CKLF (Chemokine-Like Factor (CKLF))
- Alternative Name
- CKLF (CKLF Products)
- Background
- CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.
- Molecular Weight
- 13 kDa (MW of target protein)
-