CDS1 antibody

Catalog No. ABIN634970

Product Details anti-CDS1 Antibody

Target: CDS1 (CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1 (CDS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDS1 Blocking Peptide, catalog no. 33R-9876, is also available for use as a blocking control in assays to test for specificity of this CDS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDS1

Target: CDS1 (CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1 (CDS1))

Alternative Name: CDS1 (CDS1 Products)

Synonyms: CDS antibody, 4833409J18Rik antibody, AI314024 antibody, AW125888 antibody, CDP-diacylglycerol synthase 1 antibody, CDS1 antibody, Cds1 antibody

Background: Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process