TREML2 antibody (Middle Region)
-
- Target See all TREML2 Antibodies
- TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TREML2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TREML2 antibody was raised against the middle region of TREML2
- Purification
- Affinity purified
- Immunogen
- TREML2 antibody was raised using the middle region of TREML2 corresponding to a region with amino acids TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST
- Top Product
- Discover our top product TREML2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TREML2 Blocking Peptide, catalog no. 33R-9100, is also available for use as a blocking control in assays to test for specificity of this TREML2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TREML2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))
- Alternative Name
- TREML2 (TREML2 Products)
- Background
- TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties.
- Molecular Weight
- 41 kDa (MW of target protein)
-