BTNL8 antibody (N-Term)

Catalog No. ABIN634963

Product Details anti-BTNL8 Antibody

Target: BTNL8 (Butyrophilin-Like 8 (BTNL8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTNL8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTNL8 antibody was raised against the N terminal of BTNL8

Purification: Affinity purified

Immunogen: BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTNL8 Blocking Peptide, catalog no. 33R-5692, is also available for use as a blocking control in assays to test for specificity of this BTNL8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTNL8

Target: BTNL8 (Butyrophilin-Like 8 (BTNL8))

Alternative Name: BTNL8 (BTNL8 Products)

Synonyms: Btnl8 antibody, BTNL8 antibody, butyrophilin like 8 antibody, butyrophilin-like 8 antibody, BTNL8 antibody, Btnl8 antibody, btnl8 antibody

Background: BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.

Molecular Weight: 57 kDa (MW of target protein)