STYK1 antibody (C-Term)
-
- Target See all STYK1 Antibodies
- STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STYK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STYK1 antibody was raised against the C terminal of STYK1
- Purification
- Affinity purified
- Immunogen
- STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI
- Top Product
- Discover our top product STYK1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STYK1 Blocking Peptide, catalog no. 33R-7060, is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STYK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))
- Alternative Name
- STYK1 (STYK1 Products)
- Synonyms
- wu:fc39b09 antibody, wu:fe11d05 antibody, STYK1 antibody, NOK antibody, SuRTK106 antibody, 9130025L13 antibody, AI326477 antibody, Nok antibody, RGD1564211 antibody, serine/threonine/tyrosine kinase 1 antibody, STYK1 antibody, styk1 antibody, Styk1 antibody
- Background
- Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.
- Molecular Weight
- 47 kDa (MW of target protein)
-