STYK1 antibody (C-Term)

Catalog No. ABIN634962

Product Details anti-STYK1 Antibody

Target: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STYK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STYK1 antibody was raised against the C terminal of STYK1

Purification: Affinity purified

Immunogen: STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STYK1 Blocking Peptide, catalog no. 33R-7060, is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STYK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STYK1

Target: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Alternative Name: STYK1 (STYK1 Products)

Synonyms: wu:fc39b09 antibody, wu:fe11d05 antibody, STYK1 antibody, NOK antibody, SuRTK106 antibody, 9130025L13 antibody, AI326477 antibody, Nok antibody, RGD1564211 antibody, serine/threonine/tyrosine kinase 1 antibody, STYK1 antibody, styk1 antibody, Styk1 antibody

Background: Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.

Molecular Weight: 47 kDa (MW of target protein)