OMG antibody (N-Term)
-
- Target See all OMG Antibodies
- OMG (Oligodendrocyte Myelin Glycoprotein (OMG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OMG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OMG antibody was raised against the N terminal of OMG
- Purification
- Affinity purified
- Immunogen
- OMG antibody was raised using the N terminal of OMG corresponding to a region with amino acids ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN
- Top Product
- Discover our top product OMG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OMG Blocking Peptide, catalog no. 33R-1403, is also available for use as a blocking control in assays to test for specificity of this OMG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OMG (Oligodendrocyte Myelin Glycoprotein (OMG))
- Alternative Name
- OMG (OMG Products)
- Background
- OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, Regulation of Cell Size
-